| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase, mitochondrial |
|---|
| Ligand | BDBM50121445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_154183 |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Smith, HK; Beckett, RP; Clements, JM; Doel, S; East, SP; Launchbury, SB; Pratt, LM; Spavold, ZM; Thomas, W; Todd, RS; Whittaker, M Structure-activity relationships of the peptide deformylase inhibitor BB-3497: modification of the metal binding group. Bioorg Med Chem Lett12:3595-9 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase, mitochondrial |
|---|
| Name: | Peptide deformylase, mitochondrial |
|---|
| Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27023.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_154318 |
|---|
| Residue: | 243 |
|---|
| Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
|---|
| BDBM50121445 |
|---|
| n/a |
|---|
| Name | BDBM50121445 |
|---|
| Synonyms: | (S)-2-Mercaptomethyl-hexanoic acid [(S)-5-amino-1-(4-nitro-phenylcarbamoyl)-pentyl]-amide | CHEMBL325246 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H30N4O4S |
|---|
| Mol. Mass. | 410.531 |
|---|
| SMILES | CCCC[C@H](CS)C(=O)N[C@@H](CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
