Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50121481
Substrate/Competitorn/a
Meas. Tech.ChEBML_71752
Ki 22±n/a nM
Citation Luthin DRHong YTompkins EAnderes KLPaderes GKraynov EACastro MANared-Hood KDCastillo RGregory MVazir HMay JMAnderson MB Characterization of mono- and diaminopyrimidine derivatives as novel, nonpeptide gonadotropin releasing hormone (GnRH) receptor antagonists. Bioorg Med Chem Lett 12:3635-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121481
n/a
NameBDBM50121481
Synonyms:5-(3,5,5,8,8-Pentamethyl-5,6,7,8-tetrahydro-naphthalen-2-ylmethyl)-furan-2-carboxylic acid 3-{[2-(2-methoxy-ethylamino)-pyrimidin-4-ylamino]-methyl}-benzylamide | CHEMBL121412
TypeSmall organic molecule
Emp. Form.C36H45N5O3
Mol. Mass.595.7742
SMILESCOCCNc1nccc(NCc2cccc(CNC(=O)c3ccc(Cc4cc5c(cc4C)C(C)(C)CCC5(C)C)o3)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: