Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50121483
Substrate/Competitorn/a
Meas. Tech.ChEBML_71600
Ki 11±n/a nM
Citation Luthin DRHong YTompkins EAnderes KLPaderes GKraynov EACastro MANared-Hood KDCastillo RGregory MVazir HMay JMAnderson MB Characterization of mono- and diaminopyrimidine derivatives as novel, nonpeptide gonadotropin releasing hormone (GnRH) receptor antagonists. Bioorg Med Chem Lett 12:3635-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121483
n/a
NameBDBM50121483
Synonyms:5-(3,5,5,8,8-Pentamethyl-5,6,7,8-tetrahydro-naphthalen-2-ylmethyl)-furan-2-carboxylic acid 3-{[4-(3-methoxy-propylamino)-pyrimidin-2-ylamino]-methyl}-benzylamide | CHEMBL123284
TypeSmall organic molecule
Emp. Form.C37H47N5O3
Mol. Mass.609.8008
SMILESCOCCCNc1ccnc(NCc2cccc(CNC(=O)c3ccc(Cc4cc5c(cc4C)C(C)(C)CCC5(C)C)o3)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: