| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50121732 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79946 |
|---|
| Ki | 0.470000±n/a nM |
|---|
| Citation |  Hidaka, K; Kimura, T; Hayashi, Y; McDaniel, KF; Dekhtyar, T; Colletti, L; Kiso, Y Design and synthesis of pseudo-symmetric HIV protease inhibitors containing a novel hydroxymethylcarbonyl (HMC)-hydrazide isostere. Bioorg Med Chem Lett13:93-6 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50121732 |
|---|
| n/a |
|---|
| Name | BDBM50121732 |
|---|
| Synonyms: | CHEMBL172850 | {1-[(S)-3-[N-Benzyl-N'-(3-hydroxy-2-methyl-benzoyl)-hydrazino]-2-hydroxy-3-oxo-1-((S)-phenylmethyl)-propylcarbamoyl]-2-methylsulfanyl-ethyl}-carbamic acid isoquinolin-5-ylmethyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H41N5O7S |
|---|
| Mol. Mass. | 735.848 |
|---|
| SMILES | CSC[C@H](NC(=O)OCc1cccc2cnccc12)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N(Cc1ccccc1)NC(=O)c1cccc(O)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
