Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50121735 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_79946 |
---|
Ki | 3±n/a nM |
---|
Citation | Hidaka, K; Kimura, T; Hayashi, Y; McDaniel, KF; Dekhtyar, T; Colletti, L; Kiso, Y Design and synthesis of pseudo-symmetric HIV protease inhibitors containing a novel hydroxymethylcarbonyl (HMC)-hydrazide isostere. Bioorg Med Chem Lett13:93-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50121735 |
---|
n/a |
---|
Name | BDBM50121735 |
Synonyms: | CHEMBL367679 | KNI-1277 | N-[(S)-3-[N-Benzyl-N'-(3-hydroxy-2-methyl-benzoyl)-hydrazino]-2-hydroxy-3-oxo-1-((S)-phenylmethyl)-propyl]-2-(2,6-dimethyl-phenoxy)-acetamide |
Type | Small organic molecule |
Emp. Form. | C35H37N3O6 |
Mol. Mass. | 595.6848 |
SMILES | Cc1cccc(C)c1OCC(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N(Cc1ccccc1)NC(=O)c1cccc(O)c1C |
Structure |
|