| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 5 |
|---|
| Ligand | BDBM50121838 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_49693 |
|---|
| IC50 | 0.060000±n/a nM |
|---|
| Citation |  Lynch, CL; Willoughby, CA; Hale, JJ; Holson, EJ; Budhu, RJ; Gentry, AL; Rosauer, KG; Caldwell, CG; Chen, P; Mills, SG; MacCoss, M; Berk, S; Chen, L; Chapman, KT; Malkowitz, L; Springer, MS; Gould, SL; DeMartino, JA; Siciliano, SJ; Cascieri, MA; Carella, A; Carver, G; Holmes, K; Schleif, WA; Danzeisen, R; Hazuda, D; Kessler, J; Lineberger, J; Miller, M; Emini, EA 1,3,4-Trisubstituted pyrrolidine CCR5 receptor antagonists: modifications of the arylpropylpiperidine side chains. Bioorg Med Chem Lett13:119-23 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 5 |
|---|
| Name: | C-C chemokine receptor type 5 |
|---|
| Synonyms: | C-C CKR-5 | C-C chemokine receptor type 5 | CC-CKR-5 | CCR-5 | CCR5 | CCR5/mu opioid receptor complex | CCR5_HUMAN | CD_antigen=CD195 | CHEMR13 | CMKBR5 | HIV-1 fusion coreceptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40540.21 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P51681 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
|
|
|
|---|
| BDBM50121838 |
|---|
| n/a |
|---|
| Name | BDBM50121838 |
|---|
| Synonyms: | (R)-3-cyclopropyl-2-((3S,4S)-3-((4-(3,3-difluoro-3-(4-fluorophenyl)propyl)piperidin-1-yl)methyl)-4-(3-fluorophenyl)pyrrolidin-1-yl)propanoic acid | 3-(R)-Cyclopropyl-2-[(S)-3-{4-[3,3-difluoro-3-(4-fluoro-phenyl)-propyl]-piperidin-1-ylmethyl}-4-(3-fluoro-phenyl)-pyrrolidin-1-yl]-propionic acid | CHEMBL21106 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H38F4N2O2 |
|---|
| Mol. Mass. | 546.6392 |
|---|
| SMILES | OC(=O)[C@@H](CC1CC1)N1C[C@H](CN2CCC(CCC(F)(F)c3ccc(F)cc3)CC2)[C@H](C1)c1cccc(F)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
