Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50121933
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145255
Ki 10±n/a nM
Citation Bennett MAMurray TFAldrich JV Identification of arodyn, a novel acetylated dynorphin A-(1-11) analogue, as a kappa opioid receptor antagonist. J Med Chem 45:5617-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121933
n/a
NameBDBM50121933
Synonyms:Ac-Phe-Phe-Phe-Arg-Leu-Arg-Arg-D-Ala-Arg-Pro-Lys-NH2 | CHEMBL384227
TypeSmall organic molecule
Emp. Form.C73H115N25O12
Mol. Mass.1534.8545
SMILESCC(C)C[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: