Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50121972 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159620 (CHEMBL760101) |
---|
IC50 | >90000±n/a nM |
---|
Citation | Neamati, N; Lin, Z; Karki, RG; Orr, A; Cowansage, K; Strumberg, D; Pais, GC; Voigt, JH; Nicklaus, MC; Winslow, HE; Zhao, H; Turpin, JA; Yi, J; Skalka, AM; Burke, TR; Pommier, Y Metal-dependent inhibition of HIV-1 integrase. J Med Chem45:5661-70 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50121972 |
---|
n/a |
---|
Name | BDBM50121972 |
Synonyms: | CHEMBL157373 | Compound 3 |
Type | Small organic molecule |
Emp. Form. | C28H22N4O4S4 |
Mol. Mass. | 606.759 |
SMILES | Sc1ccccc1C(=O)NNC(=O)c1ccccc1SSc1ccccc1C(=O)NNC(=O)c1ccccc1S |
Structure |
|