| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50121971 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159620 (CHEMBL760101) |
|---|
| IC50 | >90000±n/a nM |
|---|
| Citation |  Neamati, N; Lin, Z; Karki, RG; Orr, A; Cowansage, K; Strumberg, D; Pais, GC; Voigt, JH; Nicklaus, MC; Winslow, HE; Zhao, H; Turpin, JA; Yi, J; Skalka, AM; Burke, TR; Pommier, Y Metal-dependent inhibition of HIV-1 integrase. J Med Chem45:5661-70 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50121971 |
|---|
| n/a |
|---|
| Name | BDBM50121971 |
|---|
| Synonyms: | 2-Mercapto-benzoic acid N'-(2-mercapto-benzoyl)-hydrazide | CHEMBL157428 | bis(thiosalicyl)hydrazide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12N2O2S2 |
|---|
| Mol. Mass. | 304.387 |
|---|
| SMILES | Sc1ccccc1C(=O)NNC(=O)c1ccccc1S |
|---|
| Structure | 
|
|---|
Search and Browse
