Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBenzodiazepine receptors; peripheral & central
LigandBDBM50122293
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37636
Ki 0.043000±n/a nM
Citation Zhang MRMaeda JFurutsuka KYoshida YOgawa MSuhara TSuzuki K [18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). Bioorg Med Chem Lett 13:201-4 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Benzodiazepine receptors; peripheral & central
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122293
n/a
NameBDBM50122293
Synonyms:CHEMBL401000 | CHEMBL63064 | N-(2,5-Dimethoxy-benzyl)-N-(5-fluoro-2-phenoxy-phenyl)-acetamide | N-(2,5-dimethoxybenzyl)-N-(5-fluoro-2-phenoxyphenyl)-acetamide | N-(2,5-dimethoxybenzyl)-N-(5-fluoro-2-phenoxyphenyl)acetamide
TypeSmall organic molecule
Emp. Form.C23H22FNO4
Mol. Mass.395.4235
SMILESCOc1ccc(OC)c(CN(C(C)=O)c2cc(F)ccc2Oc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: