Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine nucleoside phosphorylase
LigandBDBM50122726
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162009
Ki 0.072±n/a nM
Citation Evans GBFurneaux RHGainsford GJHanson JCKicska GASauve AASchramm VLTyler PC 8-Aza-immucillins as transition-state analogue inhibitors of purine nucleoside phosphorylase and nucleoside hydrolases. J Med Chem 46:155-60 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine nucleoside phosphorylase
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:Enzyme
Mol. Mass.:32119.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122726
n/a
NameBDBM50122726
Synonyms:2-Hydroxymethyl-5-(4-hydroxy-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-pyrrolidine-3,4-diol | CHEMBL288187
TypeSmall organic molecule
Emp. Form.C11H14N4O4
Mol. Mass.266.2533
SMILESOC[C@H]1NC([C@@H](O)[C@H]1O)c1c[nH]c2c1nc[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: