Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1A
LigandBDBM50122836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46326
IC50 58800±n/a nM
Citation Giannessi FPessotto PTassoni EChiodi PConti RDe Angelis FDell'Uomo NCatini RDeias RTinti MOCarminati PArduini A Discovery of a long-chain carbamoyl aminocarnitine derivative, a reversible carnitine palmitoyltransferase inhibitor with antiketotic and antidiabetic activity. J Med Chem 46:303-9 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1A
Name:Carnitine palmitoyltransferase 1A
Synonyms:CPT I | CPT1-L | CPTI-L | Carnitine O-palmitoyltransferase I, liver isoform
Type:PROTEIN
Mol. Mass.:88147.11
Organism:Rattus norvegicus
Description:ChEMBL_887445
Residue:773
Sequence:
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPS
SWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPV
VGHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLL
ANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122836
n/a
NameBDBM50122836
Synonyms:CHEMBL102993 | [3-Carboxy-2-(3-tetradecyl-ureido)-propyl]-trimethyl-ammonium
TypeSmall organic molecule
Emp. Form.C22H45N3O3
Mol. Mass.399.611
SMILESCCCCCCCCCCCCCCNC(=O)N[C@@H](CC([O-])=O)C[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: