Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid hormone receptor
LigandBDBM50123044
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210505
Ki 0.040000±n/a nM
Citation Dow RLSchneider SRPaight ESHank RFChiang PCornelius PLee ENewsome WPSwick AGSpitzer JHargrove DMPatterson TAPandit JChrunyk BALeMotte PKDanley DERosner MHAmmirati MJSimons SPSchulte GKTate BFDaSilva-Jardine P Discovery of a novel series of 6-azauracil-based thyroid hormone receptor ligands: potent, TR beta subtype-selective thyromimetics. Bioorg Med Chem Lett 13:379-82 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thyroid hormone receptor
Name:Thyroid hormone receptor
Synonyms:Nuclear receptor subfamily 1 group A member 2 | Thyroid hormone receptor | Thyroid hormone receptor beta
Type:Receptor
Mol. Mass.:52793.62
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1.
Residue:461
Sequence:
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50123044
n/a
NameBDBM50123044
Synonyms:5-(2,6-dichloro-4-(3,5-dioxo-4,5-dihydro-1,2,4-triazin-2(3H)-yl)phenoxy)-N-(6,6-dimethylbicyclo[3.1.1]heptan-2-yl)-2-hydroxybenzamide | 5-[2,6-Dichloro-4-(3,5-dioxo-4,5-dihydro-3H-[1,2,4]triazin-2-yl)-phenoxy]-N-(6,6-dimethyl-bicyclo[3.1.1]hept-2-yl)-2-hydroxy-benzamide | CHEMBL124205
TypeSmall organic molecule
Emp. Form.C25H24Cl2N4O5
Mol. Mass.531.388
SMILESCC1(C)C2CC1C(CC2)NC(=O)c1cc(Oc2c(Cl)cc(cc2Cl)-n2ncc(=O)[nH]c2=O)ccc1O |THB:9:6:1:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: