| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50123500 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212685 (CHEMBL815470) |
|---|
| Ki | 800±n/a nM |
|---|
| Citation |  Burgey, CS; Robinson, KA; Lyle, TA; Sanderson, PE; Lewis, SD; Lucas, BJ; Krueger, JA; Singh, R; Miller-Stein, C; White, RB; Wong, B; Lyle, EA; Williams, PD; Coburn, CA; Dorsey, BD; Barrow, JC; Stranieri, MT; Holahan, MA; Sitko, GR; Cook, JJ; McMasters, DR; McDonough, CM; Sanders, WM; Wallace, AA; Clayton, FC; Bohn, D; Leonard, YM; Detwiler, TJ; Lynch, JJ; Yan, Y; Chen, Z; Kuo, L; Gardell, SJ; Shafer, JA; Vacca, JP Metabolism-directed optimization of 3-aminopyrazinone acetamide thrombin inhibitors. Development of an orally bioavailable series containing P1 and P3 pyridines. J Med Chem46:461-73 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50123500 |
|---|
| n/a |
|---|
| Name | BDBM50123500 |
|---|
| Synonyms: | CHEMBL143139 | N-(6-Amino-2-methyl-pyridin-3-ylmethyl)-2-[6-methyl-3-(2-methyl-2-phenyl-propylamino)-2-oxo-2H-pyrazin-1-yl]-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N6O2 |
|---|
| Mol. Mass. | 434.534 |
|---|
| SMILES | Cc1nc(N)ccc1CNC(=O)Cn1c(C)cnc(NCC(C)(C)c2ccccc2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
