Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50085028 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145281 (CHEMBL751217) |
---|
Ki | 5.1±n/a nM |
---|
Citation | Wentland, MP; Ye, Y; Cioffi, CL; Lou, R; Zhou, Q; Xu, G; Duan, W; Dehnhardt, CM; Sun, X; Cohen, DJ; Bidlack, JM Syntheses and opioid receptor binding affinities of 8-amino-2,6-methano-3-benzazocines. J Med Chem46:838-49 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50085028 |
---|
n/a |
---|
Name | BDBM50085028 |
Synonyms: | ((6S,11R)-3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-ethyl-amine | (3-Cyclopropylmethyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-ethyl-amine | CHEMBL55851 |
Type | Small organic molecule |
Emp. Form. | C20H30N2 |
Mol. Mass. | 298.4656 |
SMILES | CCNc1ccc2CC3[C@H](C)[C@](C)(CCN3CC3CC3)c2c1 |TLB:16:15:9:20.6.7,21:20:9:15.13.14| |
Structure |
|