Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50124453
Substrate/Competitorn/a
Meas. Tech.ChEBML_65486
IC50 2±n/a nM
Citation Bolli MHBoss CClozel MFischli WHess PWeller T The use of sulfonylamido pyrimidines incorporating an unsaturated side chain as endothelin receptor antagonists. Bioorg Med Chem Lett 13:955-9 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124453
n/a
NameBDBM50124453
Synonyms:CHEMBL175058 | Pyrazin-2-yl-carbamic acid 4-[5-(2-methoxy-phenoxy)-6-(5-methyl-pyridine-2-sulfonylamino)-2-morpholin-4-yl-pyrimidin-4-yloxy]-but-2-ynyl ester
TypeSmall organic molecule
Emp. Form.C30H30N8O8S
Mol. Mass.662.673
SMILESCOc1ccccc1Oc1c(NS(=O)(=O)c2ccc(C)cn2)nc(nc1OCC#CCOC(=O)Nc1cnccn1)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: