Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50124931
Substrate/Competitorn/a
Meas. Tech.ChEMBL_60995
Ki 3±n/a nM
Citation Zhao HZhang XHodgetts KThurkauf AHammer JChandrasekhar JKieltyka ABrodbeck RRachwal SPrimus RManly C Design, synthesis, and discovery of 5-piperazinyl-1,2,6,7-tetrahydro-5H-azepino[3,2,1-hi]indol-4-one derivatives: a novel series of mixed dopamine D2/D4 receptor antagonist. Bioorg Med Chem Lett 13:701-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:D2-like dopamine receptor
Synonyms:D(2C) dopamine receptor | D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124931
n/a
NameBDBM50124931
Synonyms:5-[4-(4-Chloro-benzyl)-piperazin-1-yl]-1,2,6,7-tetrahydro-5H-azepino[3,2,1-hi]indol-4-one | CHEMBL352207
TypeSmall organic molecule
Emp. Form.C23H26ClN3O
Mol. Mass.395.925
SMILESClc1ccc(CN2CCN(CC2)C2CCc3cccc4CCN(c34)C2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: