Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50127191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71588
Ki 1.2±n/a nM
Citation Zhu YFGuo ZGross TDGao YConnors PJStruthers RSXie QTucci FCReinhart GJWu DSaunders JChen C Design and structure-activity relationships of 2-alkyl-3-aminomethyl-6-(3-methoxyphenyl)-7-methyl-8-(2-fluorobenzyl)imidazolo[1,2-a]pyrimid-5-ones as potent GnRH receptor antagonists. J Med Chem 46:1769-72 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50127191
n/a
NameBDBM50127191
Synonyms:2-(8-(2-Fluoro-benzyl)-6-(3-methoxy-phenyl)-7-methyl-3-{[methyl-(2-pyridin-2-yl-ethyl)-amino]-methyl}-5-oxo-5,8-dihydro-imidazo[1,2-a]pyrimidin-2-yl)-2-methyl-propionic acid methyl ester | CHEMBL298982
TypeSmall organic molecule
Emp. Form.C35H38FN5O4
Mol. Mass.611.7057
SMILESCOC(=O)C(C)(C)c1nc2n(Cc3ccccc3F)c(C)c(-c3cccc(OC)c3)c(=O)n2c1CN(C)CCc1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: