Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50127222
Substrate/Competitorn/a
Meas. Tech.ChEBML_154038
EC50 30±n/a nM
Citation Sznaidman MLHaffner CDMaloney PRFivush AChao EGoreham DSierra MLLeGrumelec CXu HEMontana VGLambert MHWillson TMOliver WRSternbach DD Novel selective small molecule agonists for peroxisome proliferator-activated receptor delta (PPARdelta)--synthesis and biological activity. Bioorg Med Chem Lett 13:1517-21 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50127222
n/a
NameBDBM50127222
Synonyms:CHEMBL38508 | {4-[2-(3-Fluoro-4-trifluoromethyl-phenyl)-4-methyl-thiazol-5-ylmethylsulfanyl]-2-methyl-phenoxy}-acetic acid
TypeSmall organic molecule
Emp. Form.C21H17F4NO3S2
Mol. Mass.471.488
SMILESCc1nc(sc1CSc1ccc(OCC(O)=O)c(C)c1)-c1ccc(c(F)c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: