| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50127974 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159452 (CHEMBL766797) |
|---|
| IC50 | 0.110000±n/a nM |
|---|
| Citation |  Lu, Z; Raghavan, S; Bohn, J; Charest, M; Stahlhut, MW; Rutkowski, CA; Simcoe, AL; Olsen, DB; Schleif, WA; Carella, A; Gabryelski, L; Jin, L; Lin, JH; Emini, E; Chapman, K; Tata, JR Design and synthesis of highly potent HIV protease inhibitors with activity against resistant virus. Bioorg Med Chem Lett13:1821-4 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50127974 |
|---|
| n/a |
|---|
| Name | BDBM50127974 |
|---|
| Synonyms: | (R)-3-[(2S,4R)-2-Hydroxy-4-((3S,4S)-3-hydroxy-chroman-4-ylcarbamoyl)-5-phenyl-pentanoyl]-5,5-dimethyl-thiazolidine-4-carboxylic acid 2-chloro-6-methyl-benzylamide | CHEMBL52669 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H40ClN3O6S |
|---|
| Mol. Mass. | 666.227 |
|---|
| SMILES | Cc1cccc(Cl)c1CNC(=O)[C@H]1N(CSC1(C)C)C(=O)[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)COc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
