Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50127976 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159453 (CHEMBL766798) |
---|
IC50 | 0.120000±n/a nM |
---|
Citation | Lu, Z; Raghavan, S; Bohn, J; Charest, M; Stahlhut, MW; Rutkowski, CA; Simcoe, AL; Olsen, DB; Schleif, WA; Carella, A; Gabryelski, L; Jin, L; Lin, JH; Emini, E; Chapman, K; Tata, JR Design and synthesis of highly potent HIV protease inhibitors with activity against resistant virus. Bioorg Med Chem Lett13:1821-4 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50127976 |
---|
n/a |
---|
Name | BDBM50127976 |
Synonyms: | (R)-3-[(2S,4R)-2-Hydroxy-4-((3S,4S)-3-hydroxy-chroman-4-ylcarbamoyl)-5-phenyl-pentanoyl]-5,5-dimethyl-thiazolidine-4-carboxylic acid 2,6-dichloro-benzylamide | CHEMBL433270 |
Type | Small organic molecule |
Emp. Form. | C34H37Cl2N3O6S |
Mol. Mass. | 686.645 |
SMILES | CC1(C)SCN([C@@H]1C(=O)NCc1c(Cl)cccc1Cl)C(=O)[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)COc2ccccc12 |
Structure |
|