Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA1
LigandBDBM50002370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90149
Ki 22±n/a nM
Citation Bjerrum EJKristensen ASPickering DSGreenwood JRNielsen BLiljefors TSchousboe ABräuner-Osborne HMadsen U Design, synthesis, and pharmacology of a highly subtype-selective GluR1/2 agonist, (RS)-2-amino-3-(4-chloro-3-hydroxy-5-isoxazolyl)propionic acid (Cl-HIBO). J Med Chem 46:2246-9 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA1
Name:Glutamate receptor AMPA 1/2
Synonyms:AMPA-selective glutamate receptor 1 | GluR-1 | GluR-A | GluR-K1 | Glutamate AMPA 1 | Glutamate receptor 1 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 1
Type:Enzyme Catalytic Domain
Mol. Mass.:101512.92
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 1 GRIA1 HUMAN::P42261
Residue:906
Sequence:
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002370
n/a
NameBDBM50002370
Synonyms:(R,S)-alpha-amino-3-hydroxy-5-methyl-4-isooxazole-propionic acid | (RS)-2-amino-3-(3-hydroxy-5-methylisoxazol-4-yl)-propionicacid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid(DL-AMPA) | 2-amino-3-(3-hydroxy-5-methyl-4-isoxazolyl)-propionic acid | 2-amino-3-(5-methyl-3-oxo-2,3-dihydroisoxazol-4-yl)propanoic acid | 2-ammonio-3-(3-hydroxy-5-methylisoxazol-4-yl)propanoate | AMPA | CHEMBL13378
TypeSmall organic molecule
Emp. Form.C7H10N2O4
Mol. Mass.186.1653
SMILESCc1o[nH]c(=O)c1CC(N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: