Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen receptor
LigandBDBM50128400
Substrate/Competitorn/a
Meas. Tech.ChEBML_67514
Ki 1.7±n/a nM
Citation Wallace OBLauwers KSJones SADodge JA Tetrahydroquinoline-based selective estrogen receptor modulators (SERMs). Bioorg Med Chem Lett 13:1907-10 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Estrogen receptor
Name:Baculoviral IAP repeat-containing protein 2/Estrogen receptor
Synonyms:ER | ER-alpha | ESR | ESR1 | Estradiol receptor | Estrogen receptor (ER alpha) | Estrogen receptor (ER-alpha) | Estrogen receptor alpha (ER alpha) | Estrogen receptor alpha (ER) | NR3A1 | Nuclear receptor subfamily 3 group A member 1
Type:Protein
Mol. Mass.:66230.44
Organism:Homo sapiens (Human)
Description:P03372
Residue:595
Sequence:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128400
n/a
NameBDBM50128400
Synonyms:2-Phenyl-1-[4-(2-piperidin-1-yl-ethoxy)-benzyl]-1,2,3,4-tetrahydro-quinolin-6-ol | CHEMBL60538
TypeSmall organic molecule
Emp. Form.C29H34N2O2
Mol. Mass.442.5925
SMILESOc1ccc2N(Cc3ccc(OCCN4CCCCC4)cc3)C(CCc2c1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: