Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50128869 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_90369 (CHEMBL697045) |
---|
Ki | >25000±n/a nM |
---|
Citation | Medrano, FJ; Wenck, MA; Engel, JC; Craig, SP Analysis of 6-(2,2-Dichloroacetamido)chrysene interaction with the hypoxanthine phosphoribosyltransferase from Trypanosoma cruzi. J Med Chem46:2548-50 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50128869 |
---|
n/a |
---|
Name | BDBM50128869 |
Synonyms: | 2,2-Dichloro-N-chrysen-6-yl-acetamide | CHEMBL88057 |
Type | Small organic molecule |
Emp. Form. | C20H13Cl2NO |
Mol. Mass. | 354.229 |
SMILES | ClC(Cl)C(=O)Nc1cc2c3ccccc3ccc2c2ccccc12 |
Structure |
|