Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 5 ( NPY Y5)
LigandBDBM50128944
Substrate/Competitorn/a
Meas. Tech.ChEBML_144128
Ki 8±n/a nM
Citation Hammond MElliott RLGillaspy MLHager DCHank RFLaFlamme JAOliver RMDaSilva-Jardine PAStevenson RWMack CMCassella JV Structure-activity relationships in a series of NPY Y5 antagonists: 3-amido-9-ethylcarbazoles, core-modified analogues and amide isosteres. Bioorg Med Chem Lett 13:1989-92 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 5 ( NPY Y5)
Name:Neuropeptide Y receptor type 5
Synonyms:NPY-Y5 | NPY-Y5 receptor | NPY5-R | NPY5R | NPYY5 | Y5 receptor
Type:Enzyme
Mol. Mass.:50746.64
Organism:Homo sapiens (Human)
Description:Q15761
Residue:445
Sequence:
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128944
n/a
NameBDBM50128944
Synonyms:9-Ethyl-3-(9H-purin-8-yl)-9H-carbazole | CHEMBL61175
TypeSmall organic molecule
Emp. Form.C19H15N5
Mol. Mass.313.3559
SMILESCCn1c2ccccc2c2cc(ccc12)-c1nc2ncncc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: