Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBone morphogenetic protein 1
LigandBDBM50129209
Substrate/Competitorn/a
Meas. Tech.ChEBML_158890
Ki 22±n/a nM
Citation Delaet NGRobinson LAWilson DMSullivan RWBradley EKDankwardt SMMartin RLVan Wart HEWalker KA Novel inhibitors of procollagen C-terminal proteinase. Part 1: diamino Acid hydroxamates. Bioorg Med Chem Lett 13:2101-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bone morphogenetic protein 1
Name:Bone morphogenetic protein 1
Synonyms:BMP-1 | Mammalian tolloid protein | PCP | Procollagen C-proteinase | mTld
Type:PROTEIN
Mol. Mass.:111254.03
Organism:Homo sapiens (Human)
Description:ChEMBL_518962
Residue:986
Sequence:
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129209
n/a
NameBDBM50129209
Synonyms:2-[Benzo[1,3]dioxol-5-ylmethyl-((R)-4-methoxy-benzenesulfonyl)-amino]-3-[3-(4-ethoxy-phenyl)-ureido]-N-hydroxy-propionamide | CHEMBL66321
TypeSmall organic molecule
Emp. Form.C27H30N4O9S
Mol. Mass.586.613
SMILESCCOc1ccc(NC(=O)NC[C@@H](N(Cc2ccc3OCOc3c2)S(=O)(=O)c2ccc(OC)cc2)C(=O)NO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: