Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50129721
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196008
Ki 10000±n/a nM
Citation Michellys PYArdecky RJChen JHCrombie DLEtgen GJFaul MMFaulkner ALGrese TAHeyman RAKaranewsky DSKlausing KLeibowitz MDLiu SMais DAMapes CMMarschke KBReifel-Miller AOgilvie KMRungta DThompson AWTyhonas JSBoehm MF Novel (2E,4E,6Z)-7-(2-alkoxy-3,5-dialkylbenzene)-3-methylocta-2,4,6-trienoic acid retinoid X receptor modulators are active in models of type 2 diabetes. J Med Chem 46:2683-96 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/gamma
Synonyms:Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor gamma
Type:PROTEIN
Mol. Mass.:50345.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1458016
Residue:454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129721
n/a
NameBDBM50129721
Synonyms:7-[2-(2,2-Difluoro-ethoxy)-3,5-bis-(1,1-dimethyl-propyl)-phenyl]-3-methyl-octa-2,4,6-trienoic acid | CHEMBL313647
TypeSmall organic molecule
Emp. Form.C27H38F2O3
Mol. Mass.448.5856
SMILESCCC(C)(C)c1cc(\C(C)=C/C=C/C(/C)=C/C(O)=O)c(OCC(F)F)c(c1)C(C)(C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: