Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBone morphogenetic protein 1
LigandBDBM50130118
Substrate/Competitorn/a
Meas. Tech.ChEBML_158896
Ki 280±n/a nM
Citation Robinson LAWilson DMDelaet NGBradley EKDankwardt SMCampbell JAMartin RLVan Wart HEWalker KASullivan RW Novel inhibitors of procollagen C-proteinase. Part 2: glutamic acid hydroxamates. Bioorg Med Chem Lett 13:2381-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bone morphogenetic protein 1
Name:Bone morphogenetic protein 1
Synonyms:BMP-1 | Mammalian tolloid protein | PCP | Procollagen C-proteinase | mTld
Type:PROTEIN
Mol. Mass.:111254.03
Organism:Homo sapiens (Human)
Description:ChEMBL_518962
Residue:986
Sequence:
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130118
n/a
NameBDBM50130118
Synonyms:(R)-2-[Benzo[1,3]dioxol-5-ylmethyl-(4-methoxy-benzenesulfonyl)-amino]-pentanedioic acid 1-hydroxyamide 5-(isobutyl-amide) | CHEMBL76299
TypeSmall organic molecule
Emp. Form.C24H31N3O8S
Mol. Mass.521.583
SMILESCOc1ccc(cc1)S(=O)(=O)N(Cc1ccc2OCOc2c1)[C@H](CCC(=O)NCC(C)C)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: