Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50011320 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_138607 (CHEMBL746911) |
---|
Ki | 25.9±n/a nM |
---|
Citation | Pineda, P; Kanter, A; McIvor, RS; Benkovic, SJ; Rosowsky, A; Wagner, CR Dihydrofolate reductase mutant with exceptional resistance to methotrexate but not to trimetrexate. J Med Chem46:2816-8 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50011320 |
---|
n/a |
---|
Name | BDBM50011320 |
Synonyms: | CHEMBL18155 | N-(4-Carboxy-4-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-butyl)-phthalamic acid | N-(4-Carboxy-4-{4-[(2,4-diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-butyl)-phthalamic acid(PT523) |
Type | Small organic molecule |
Emp. Form. | C27H27N9O6 |
Mol. Mass. | 573.56 |
SMILES | Nc1nc(N)c2nc(CNc3ccc(cc3)C(=O)NC(CCCNC(=O)c3ccccc3C(O)=O)C(O)=O)cnc2n1 |
Structure |
|