Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM50130617
Substrate/Competitorn/a
Meas. Tech.ChEMBL_148859
Ki 0.05±n/a nM
Citation Okada YTsuda YFujita YYokoi TSasaki YAmbo AKonishi RNagata MSalvadori SJinsmaa YBryant SDLazarus LH Unique high-affinity synthetic mu-opioid receptor agonists with central- and systemic-mediated analgesia. J Med Chem 46:3201-9 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130617
n/a
NameBDBM50130617
Synonyms:2-Amino-N-{6-[2-amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionylamino]-hexyl}-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionamide | CHEMBL108808
TypeSmall organic molecule
Emp. Form.C28H42N4O4
Mol. Mass.498.6575
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)NCCCCCCNC(=O)[C@H](N)Cc1c(C)cc(O)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: