Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50131114
Substrate/Competitorn/a
Meas. Tech.ChEBML_69451
Ki 1.1±n/a nM
Citation Das JMoquin RVLin JLiu CDoweyko AMDeFex HFFang QPang SPitt SShen DRSchieven GLBarrish JCWityak J Discovery of 2-amino-heteroaryl-benzothiazole-6-anilides as potent p56(lck) inhibitors. Bioorg Med Chem Lett 13:2587-90 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:5-HT6 | FYN | HTR6 | Tyrosine Kinase FYN | Tyrosine-protein kinase Fyn | Tyrosine-protein kinase Fyn (Fyn)
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131114
n/a
NameBDBM50131114
Synonyms:2-{6-Methyl-2-[(tetrahydro-furan-2-ylmethyl)-amino]-pyrimidin-4-ylamino}-benzothiazole-6-carboxylic acid (2-chloro-6-methyl-phenyl)-amide | CHEMBL432189
TypeSmall organic molecule
Emp. Form.C25H25ClN6O2S
Mol. Mass.509.023
SMILESCc1cc(Nc2nc3ccc(cc3s2)C(=O)Nc2c(C)cccc2Cl)nc(NCC2CCCO2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: