| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50131202 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_44674 |
|---|
| IC50 | 4200±n/a nM |
|---|
| Citation |  Baxter, A; Bennion, C; Bent, J; Boden, K; Brough, S; Cooper, A; Kinchin, E; Kindon, N; McInally, T; Mortimore, M; Roberts, B; Unitt, J Hit-to-lead studies: the discovery of potent, orally bioavailable triazolethiol CXCR2 receptor antagonists. Bioorg Med Chem Lett13:2625-8 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 2 |
|---|
| Name: | C-X-C chemokine receptor type 2 |
|---|
| Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40767.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25025 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
|---|
| BDBM50131202 |
|---|
| n/a |
|---|
| Name | BDBM50131202 |
|---|
| Synonyms: | 5-(2,4-Dichloro-phenyl)-2-(3-methoxy-benzyl)-2H-[1,2,4]triazole-3-thiol | CHEMBL315206 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13Cl2N3OS |
|---|
| Mol. Mass. | 366.265 |
|---|
| SMILES | COc1cccc(Cn2nc([nH]c2=S)-c2ccc(Cl)cc2Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
