Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5
LigandBDBM50132108
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3595
Ki 135±n/a nM
Citation Khorana NSmith CHerrick-Davis KPurohit ATeitler MGrella BDukat MGlennon RA Binding of tetrahydrocarboline derivatives at human 5-HT5A receptors. J Med Chem 46:3930-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-HT5
Name:5-HT5
Synonyms:5-HT-5 | 5-HT-5A | 5-HT5a | 5-hydroxytryptamine receptor 5A | Serotonin 5a (5-HT5a) receptor | Serotonin receptor 5A
Type:Enzyme Catalytic Domain
Mol. Mass.:40749.33
Organism:MOUSE
Description:5-HT5 0 MOUSE::P30966
Residue:357
Sequence:
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132108
n/a
NameBDBM50132108
Synonyms:4-(5-Methyl-1,3,4,5-tetrahydro-pyrido[4,3-b]indol-2-yl)-1-phenyl-butan-1-one | CHEMBL129476
TypeSmall organic molecule
Emp. Form.C22H24N2O
Mol. Mass.332.4388
SMILESCn1c2CCN(CCCC(=O)c3ccccc3)Cc2c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: