Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50132089
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3584
Ki 185±n/a nM
Citation Khorana NSmith CHerrick-Davis KPurohit ATeitler MGrella BDukat MGlennon RA Binding of tetrahydrocarboline derivatives at human 5-HT5A receptors. J Med Chem 46:3930-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A | 5-hydroxytryptamine receptor 5A (5-HT5A) | Serotonin receptor 5A
Type:Enzyme
Mol. Mass.:40266.25
Organism:Homo sapiens (Human)
Description:P47898
Residue:357
Sequence:
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132089
n/a
NameBDBM50132089
Synonyms:5-Methyl-2-(5-phenyl-pent-2-enyl)-2,3,4,5-tetrahydro-1H-pyrido[4,3-b]indole | CHEMBL446356
TypeSmall organic molecule
Emp. Form.C23H26N2
Mol. Mass.330.4659
SMILESCn1c2CCN(C\C=C\CCc3ccccc3)Cc2c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: