Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM50132112
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2829
Ki 115±n/a nM
Citation Khorana NSmith CHerrick-Davis KPurohit ATeitler MGrella BDukat MGlennon RA Binding of tetrahydrocarboline derivatives at human 5-HT5A receptors. J Med Chem 46:3930-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132112
n/a
NameBDBM50132112
Synonyms:1-Phenyl-4-(1,3,4,9-tetrahydro-beta-carbolin-2-yl)-butan-1-one | CHEMBL129163
TypeSmall organic molecule
Emp. Form.C21H22N2O
Mol. Mass.318.4122
SMILESO=C(CCCN1CCc2c(C1)[nH]c1ccccc21)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: