Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50132579
Substrate/Competitorn/a
Meas. Tech.ChEBML_196011
Ki>10000±n/a nM
Citation Gernert DLAjamie RArdecky RABell MGLeibowitz MDMais DAMapes CMMichellys PYRungta DReifel-Miller ATyhonas JSYumibe NGrese TA Design and synthesis of fluorinated RXR modulators. Bioorg Med Chem Lett 13:3191-5 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/gamma
Synonyms:Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor gamma
Type:PROTEIN
Mol. Mass.:50345.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1458016
Residue:454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132579
n/a
NameBDBM50132579
Synonyms:(2E,4E,6Z)-7-(2-Butoxy-3,5-di-tert-butyl-phenyl)-3-methyl-octa-2,4,6-trienoic acid | CHEMBL110195
TypeSmall organic molecule
Emp. Form.C27H40O3
Mol. Mass.412.6047
SMILESCCCCOc1c(cc(cc1C(C)(C)C)C(C)(C)C)C(\C)=C/C=C/C(/C)=C/C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: