Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide deformylase mitochondrial
LigandBDBM50089194
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154317
IC50 1.5±n/a nM
Citation Takayama WShirasaki YSakai YNakajima EFujita SSakamoto-Mizutani KInoue J Synthesis and PDF inhibitory activities of novel benzothiazolylidenehydroxamic acid derivatives. Bioorg Med Chem Lett 13:3273-6 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Peptide deformylase mitochondrial
Name:Peptide deformylase mitochondrial
Synonyms:Peptide deformylase, mitochondrial | Polypeptide deformylase
Type:PROTEIN
Mol. Mass.:27023.25
Organism:Homo sapiens (Human)
Description:ChEMBL_154318
Residue:243
Sequence:
MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089194
n/a
NameBDBM50089194
Synonyms:(R)-N*4*-Hydroxy-N*1*-[(S)-1-((S)-2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-pentyl-succinamide | (R)-N4-hydroxy-N1-((S)-1-((S)-2-(hydroxymethyl)pyrrolidin-1-yl)-3-methyl-1-oxobutan-2-yl)-2-pentylsuccinamide | ACTINONIN | CHEMBL308333 | N*4*-Hydroxy-N*1*-[(S)-1-((S)-2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-(R)-pentyl-succinamide | N*4*-Hydroxy-N*1*-[1-(2-hydroxymethyl-pyrrolidine-1-carbonyl)-2-methyl-propyl]-2-pentyl-succinamide
TypeSmall organic molecule
Emp. Form.C19H35N3O5
Mol. Mass.385.4983
SMILESCCCCC[C@H](CC(=O)NO)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: