Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50132716
Substrate/Competitorn/a
Meas. Tech.ChEBML_68783
IC50 3±n/a nM
Citation Segall YQuistad GBNomura DKCasida JE Arachidonylsulfonyl derivatives as cannabinoid CB1 receptor and fatty acid amide hydrolase inhibitors. Bioorg Med Chem Lett 13:3301-3 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | FAAH | Fatty Acid Amide Hydrolase | Fatty Acid Amide Hydrolic, FAAH | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Fatty-acid amide hydrolase 1 (FAAH) | Oleamide hydrolase 1
Type:Single-pass membrane protein; homodimer
Mol. Mass.:63364.46
Organism:Rattus norvegicus (rat)
Description:Membranes prepared from rat brain were used in assay.
Residue:579
Sequence:
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132716
n/a
NameBDBM50132716
Synonyms:CHEMBL113263 | methyl dodecylphosphonofluoridoate
TypeSmall organic molecule
Emp. Form.C13H28FO2P
Mol. Mass.266.3324
SMILESCCCCCCCCCCCCP(F)(=O)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: