Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM22988
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46474
IC50 12000±n/a nM
Citation Segall YQuistad GBNomura DKCasida JE Arachidonylsulfonyl derivatives as cannabinoid CB1 receptor and fatty acid amide hydrolase inhibitors. Bioorg Med Chem Lett 13:3301-3 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22988
n/a
NameBDBM22988
Synonyms:(5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)icosa-5,8,11,14-tetraenamide | AEA | ANANDAMIDE | Arachidonoyl ethanolamide | Arachidonoyl ethanolamide (AEA) | Arachidonoylethanolamide (AEA) | Arachidonylethanolamide | CHEMBL15848 | [14C]Anandamide | [3H]Anandamide
Typeradiolabeled substrate
Emp. Form.C22H37NO2
Mol. Mass.347.5347
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: