Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 5 ( NPY Y5)
LigandBDBM50133762
Substrate/Competitorn/a
Meas. Tech.ChEBML_144129
Ki 4.9±n/a nM
Citation Elliott RLOliver RMLaFlamme JAGillaspy MLHammond MHank RFMaurer TSBaker DLDaSilva-Jardine PAStevenson RWMack CMCassella JV Structure-activity relationship studies on 2-heteroaryl-4-arylimidazoles NPY5 receptor antagonists. Bioorg Med Chem Lett 13:3593-6 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 5 ( NPY Y5)
Name:Neuropeptide Y receptor type 5
Synonyms:NPY-Y5 | NPY-Y5 receptor | NPY5-R | NPY5R | NPYY5 | Y5 receptor
Type:Enzyme
Mol. Mass.:50746.64
Organism:Homo sapiens (Human)
Description:Q15761
Residue:445
Sequence:
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133762
n/a
NameBDBM50133762
Synonyms:3-[5-(3-Trifluoromethoxy-phenyl)-1H-imidazol-2-yl]-pyridine | CHEMBL120586
TypeSmall organic molecule
Emp. Form.C15H10F3N3O
Mol. Mass.305.2546
SMILESFC(F)(F)Oc1cccc(c1)-c1c[nH]c(n1)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: