Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGeranylgeranyl transferase type I beta subunit/Protein Farnesyltransferase (PFT)
LigandBDBM50134313
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71960
IC50>100000±n/a nM
Citation Vigushin DMBrooke GWillows DCoombes RCMoody CJ Pyrazino[1,2-a]indole-1,4-diones, simple analogues of gliotoxin, as selective inhibitors of geranylgeranyltransferase I. Bioorg Med Chem Lett 13:3661-3 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Geranylgeranyl transferase type I beta subunit/Protein Farnesyltransferase (PFT)
Name:Geranylgeranyl transferase type I beta subunit/Protein Farnesyltransferase (PFT)
Synonyms:Geranylgeranyl transferase type I | Geranylgeranyl transferase type I beta/Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 70196
Components:This complex has 2 components.
Component 1
Name:Geranylgeranyl transferase type I
Synonyms:CAAX farnesyltransferase alpha subunit | FTase-1-alpha | FTase-alpha | GGTase-I-alpha | Geranylgeranyl Transferase (GGTase-I) Chain A | Protein Farnesyltransferase (PFT) Chain A | Protein farnesyltransferase | Protein farnesyltransferase subunit alpha | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Ras proteins prenyltransferase alpha
Type:Enzyme
Mol. Mass.:44392.46
Organism:Homo sapiens (Human)
Description:Recombinant human FTase.
Residue:379
Sequence:
MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Geranylgeranyl transferase type I
Synonyms:GGTase-I-beta | Geranylgeranyl transferase type I beta subunit | Geranylgeranyl transferase type I subunit beta | Geranylgeranyl transferase type-1 subunit beta | PGGT1B | Protein farnesyl/geranylgeranyl transferase | Type I protein geranyl-geranyltransferase subunit beta
Type:n/a
Mol. Mass.:42369.84
Organism:Homo sapiens (Human)
Description:n/a
Residue:377
Sequence:
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134313
n/a
NameBDBM50134313
Synonyms:2-Methyl-2,3-dihydro-pyrazino[1,2-a]indole-1,4-dione | CHEMBL420726
TypeSmall organic molecule
Emp. Form.C12H10N2O2
Mol. Mass.214.22
SMILESCN1CC(=O)n2c(cc3ccccc23)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: