Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepinephrine & serotonin
LigandBDBM50135265
Substrate/Competitorn/a
Meas. Tech.ChEBML_194030
Ki 0.920000±n/a nM
Citation Takeuchi KKohn TJHonigschmidt NARocco VPSpinazze PGAtkinson STHertel LWNelson DLWainscott DBAhmad LJShaw JThrelkeld PGWong DT Advances toward new antidepressants beyond SSRIs: 1-aryloxy-3-piperidinylpropan-2-ols with dual 5-HT1A receptor antagonism/SSRI activities. Part 3. Bioorg Med Chem Lett 13:3939-42 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepinephrine & serotonin
Name:Monoamine transporters; Norepinephrine & serotonin
Synonyms:5-HT Transporter | 5-HTT | 5HT transporter | 5HTT | Anandamid membrane transporter, AMT | Anandamide membrane transporter, AMT | Sodium-dependent serotonin transporter (SERT) | imipramine receptor
Type:Multi-pass membrane protein
Mol. Mass.:70168.43
Organism:Rattus norvegicus (rat)
Description:P31652
Residue:630
Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135265
n/a
NameBDBM50135265
Synonyms:(S)-1-[(2S,4R)-4-(4-Fluoro-benzo[b]thiophen-2-yl)-2-methyl-piperidin-1-yl]-3-(2-methyl-1H-indol-4-yloxy)-propan-2-ol | CHEMBL129082
TypeSmall organic molecule
Emp. Form.C26H29FN2O2S
Mol. Mass.452.584
SMILESC[C@H]1C[C@@H](CCN1C[C@H](O)COc1cccc2[nH]c(C)cc12)c1cc2c(F)cccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: