Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50135288
Substrate/Competitorn/a
Meas. Tech.ChEBML_196715
Ki 180±n/a nM
Citation Kitade YKojima HZulfiqur FKim HSWataya Y Synthesis of 2-fluoronoraristeromycin and its inhibitory activity against Plasmodium falciparum S-adenosyl-L-homocysteine hydrolase. Bioorg Med Chem Lett 13:3963-5 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:AdoHcyase | PfSAHH | S-adenosyl-L-homocysteine hydrolase
Type:PROTEIN
Mol. Mass.:53833.80
Organism:Plasmodium falciparum 3D7
Description:ChEMBL_196715
Residue:479
Sequence:
MVENKSKVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECA
LLIETLQKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTW
GDGDDNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSI
LKNPKKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDNVYGCR
HSLPDGLMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAIQAVMEG
FNVVTLDEIVDKGDFFITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKG
IHIENVKPQVDRITLPNGNKIIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQN
KDTNKYENKVYLLPKHLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135288
n/a
NameBDBM50135288
Synonyms:(1S,2R,3S,4R)-4-(6-Amino-purin-9-yl)-cyclopentane-1,2,3-triol | (1S,2R,3S,4R)-4-(6-amino-9H-purin-9-yl)cyclopentane-1,2,3-triol | CHEMBL129014 | NORARISTEROMYCIN
TypeSmall organic molecule
Emp. Form.C10H13N5O3
Mol. Mass.251.2419
SMILESNc1ncnc2n(cnc12)[C@@H]1C[C@H](O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: