Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase LCK
LigandBDBM13224
Substrate/Competitorn/a
Meas. Tech.ChEBML_221476
IC50 320±n/a nM
Citation Wityak JDas JMoquin RVShen ZLin JChen PDoweyko AMPitt SPang SShen DRFang Qde Fex HFSchieven GLKanner SBBarrish JC Discovery and initial SAR of 2-amino-5-carboxamidothiazoles as inhibitors of the Src-family kinase p56(Lck). Bioorg Med Chem Lett 13:4007-10 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase LCK
Name:Tyrosine-protein kinase LCK
Synonyms:LSK | Lymphocyte cell-specific protein-tyrosine kinase | Proto-oncogene tyrosine-protein kinase LCK | p56-LCK
Type:PROTEIN
Mol. Mass.:57927.84
Organism:Mus musculus
Description:ChEMBL_806408
Residue:509
Sequence:
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13224
n/a
NameBDBM13224
Synonyms:2-N-benzene-4-methyl-5-N-(2,4,6-trimethylphenyl)-1,3-thiazole-2,5-diamido | BMS-354825 2-Amino-4-methyl-thiazole Analog 7d | CHEMBL130719
TypeSmall organic molecule
Emp. Form.C21H21N3O2S
Mol. Mass.379.475
SMILESCc1nc(NC(=O)c2ccccc2)sc1C(=O)Nc1c(C)cc(C)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: