Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM50135851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31765
IC50 6400±n/a nM
Citation de la Fuente JAManzanaro SMartín MJde Quesada TGReymundo ILuengo SMGago F Synthesis, activity, and molecular modeling studies of novel human aldose reductase inhibitors based on a marine natural product. J Med Chem 46:5208-21 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135851
n/a
NameBDBM50135851
Synonyms:2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxy-phenoxy)-phenol | 2,3,4,5-tetrabromo-6-(3,5-dibromo-2-hydroxyphenoxy)phenol | CHEMBL150098
TypeSmall organic molecule
Emp. Form.C12H4Br6O3
Mol. Mass.675.582
SMILESOc1c(Br)cc(Br)cc1Oc1c(O)c(Br)c(Br)c(Br)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: