Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase M
LigandBDBM50135939
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45790
IC50 13±n/a nM
Citation Barrow JCNantermet PGStauffer SRNgo PLSteinbeiser MAMao SSCarroll SSBailey CColussi DBosserman MBurlein CCook JJSitko GTiller PRMiller-Stein CMRose MMcMasters DRVacca JPSelnick HG Synthesis and evaluation of imidazole acetic acid inhibitors of activated thrombin-activatable fibrinolysis inhibitor as novel antithrombotics. J Med Chem 46:5294-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase M
Name:Carboxypeptidase M
Synonyms:CPM
Type:PROTEIN
Mol. Mass.:50519.81
Organism:Homo sapiens (Human)
Description:ChEMBL_45790
Residue:443
Sequence:
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP
DHSAATKPSLFLFLVSLLHIFFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135939
n/a
NameBDBM50135939
Synonyms:3-(4,4-Diamino-but-3-enylsulfanyl)-2-mercaptomethyl-propionic acid | CHEMBL150332
TypeSmall organic molecule
Emp. Form.C8H16N2O2S2
Mol. Mass.236.355
SMILESNC(=N)CCCSCC(CS)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: