| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50104975 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212589 (CHEMBL811891) |
|---|
| Ki | 2.8±n/a nM |
|---|
| Citation |  Xue, CB; He, X; Roderick, J; Corbett, RL; Duan, JJ; Liu, RQ; Covington, MB; Newton, RC; Trzaskos, JM; Magolda, RL; Wexler, RR; Decicco, CP Rational design, synthesis and structure-activity relationships of a cyclic succinate series of TNF-alpha converting enzyme inhibitors. Part 1: lead identification. Bioorg Med Chem Lett13:4293-7 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50104975 |
|---|
| n/a |
|---|
| Name | BDBM50104975 |
|---|
| Synonyms: | (8S,11R,12S)-2,10-Dioxo-11-(2'-trifluoromethyl-biphenyl-4-ylmethyl)-1-oxa-3,9-diaza-cyclopentadecane-8,12-dicarboxylic acid 12-hydroxyamide 8-[(2-morpholin-4-yl-2-oxo-ethyl)-amide] | (8S,11R,12S)-N12-hydroxy-N8-(2-morpholino-2-oxoethyl)-2,10-dioxo-11-((2'-(trifluoromethyl)biphenyl-4-yl)methyl)-1-oxa-3,9-diazacyclopentadecane-8,12-dicarboxamide | 2,10-Dioxo-11-(2'-trifluoromethyl-biphenyl-4-ylmethyl)-1-oxa-3,9-diaza-cyclopentadecane-8,12-dicarboxylic acid 12-hydroxyamide 8-[(2-morpholin-4-yl-2-oxo-ethyl)-amide] | CHEMBL325163 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H42F3N5O8 |
|---|
| Mol. Mass. | 705.7212 |
|---|
| SMILES | ONC(=O)[C@H]1CCCOC(=O)NCCCC[C@H](NC(=O)[C@@H]1Cc1ccc(cc1)-c1ccccc1C(F)(F)F)C(=O)NCC(=O)N1CCOCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
