Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM9019
Substrate/Competitorn/a
Meas. Tech.ChEBML_105266
Ki 0.300000±n/a nM
Citation Sun LQChen JMattson RJEpperson JRDeskus JALi WSTakaki KHodges DBIben LMahle CDOrtiz AMolstad DRyan EYeleswaram KXu CLuo G Heterocyclic aminopyrrolidine derivatives as melatoninergic agents. Bioorg Med Chem Lett 13:4381-4 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9019
n/a
NameBDBM9019
Synonyms:CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide
TypeSmall organic molecule
Emp. Form.C13H16N2O2
Mol. Mass.232.2783
SMILESCOc1ccc2[nH]cc(CCNC(C)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: