Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-2 subunit/subunit beta-4
LigandBDBM50049757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143234
Ki 0.091000±n/a nM
Citation Bremner JBGodfrey CAJensen AASmith RJ Synthesis and nicotinic receptor activity of a hydroxylated tropane. Bioorg Med Chem Lett 14:271-3 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-2 subunit/subunit beta-4
Name:Neuronal acetylcholine receptor protein alpha-2 subunit/subunit beta-4
Synonyms:Neuronal acetylcholine receptor; alpha2/beta4
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 306297
Components:This complex has 2 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:59759.69
Organism:Homo sapiens (Human)
Description:Cholinergic, Nicotinic Alpha2Beta2 0 HUMAN::Q15822
Residue:529
Sequence:
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Integrin alpha-5/Neuronal acetylcholine receptor subunit alpha-3/Neuronal acetylcholine receptor subunit beta-2/Neuronal acetylcholine receptor subunit beta-4
Synonyms:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Type:Enzyme Catalytic Domain
Mol. Mass.:56388.51
Organism:Homo sapiens (Human)
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 HUMAN::P30926
Residue:498
Sequence:
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50049757
n/a
NameBDBM50049757
Synonyms:()-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (+)-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (+)-epibatidine | (-)-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (1R,2R,4S)-epibatidine | (2R)-2-(6-chloropyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane hydrochloride | (2R,4S)-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (2R,4S)-2-(6-Iodo-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (2R,4S)-2-(6-chloropyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (R)-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | (R)-2-(6-Chloro-pyridin-3-yl)-7-methyl-7-aza-bicyclo[2.2.1]heptane | 2-(6-Chloro-pyridin-3-yl)-5-methyl-7-aza-bicyclo[2.2.1]heptane | 2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | 2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane (epibatidine) | 2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane(+/-) epibatidine | 2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane(Epibatidine) | 2-(6-Chloro-pyridin-3-yl)-7-azonia-bicyclo[2.2.1]heptane | 2-(6-chloropyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | 2-Pyridin-3-yl-7-aza-bicyclo[2.2.1]heptane | CHEMBL6623 | EPIBATIDINE | Epibatidine, (+/-) | Epibatidine-(+) | Epibatidine-(-) | exo-2-(6-chloropyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | rac-(2R)-2-(6-chloropyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane
TypeSmall organic molecule
Emp. Form.C11H13ClN2
Mol. Mass.208.687
SMILESClc1ccc(cn1)C1CC2CCC1N2 |TLB:4:7:11.10:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: