Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50137839
Substrate/Competitorn/a
Meas. Tech.ChEBML_87538
IC50 2000±n/a nM
Citation Vaisburg ABernstein NFrechette SAllan MAbou-Khalil ELeit SMoradei OBouchain GWang JWoo SHFournel MYan PTTrachy-Bourget MCKalita ABeaulieu CLi ZMacLeod ARBesterman JMDelorme D (2-amino-phenyl)-amides of omega-substituted alkanoic acids as new histone deacetylase inhibitors. Bioorg Med Chem Lett 14:283-7 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1/6
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Purified from NIH 3T3 cells harboring human HDAC1 using an anti-FLAG M2 antibody.
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137839
n/a
NameBDBM50137839
Synonyms:6-(5-Hydroxy-1,3-dioxo-6-piperidin-1-ylmethyl-1H,3H-benzo[de]isoquinolin-2-yl)-hexanoic acid (2-amino-phenyl)-amide | CHEMBL329745
TypeSmall organic molecule
Emp. Form.C30H34N4O4
Mol. Mass.514.6154
SMILESNc1ccccc1NC(=O)CCCCCN1C(=O)c2cccc3c(CN4CCCCC4)c(O)cc(C1=O)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: